Recombinant SARS-CoV-2, S1 Protein

Pricing & Details

  
Alternate Names
Spike Protein, S1 Subunit Protein
Expression Host
HEK-293
Reactivity Species
SARS-CoV-2
Virus
Prod No.
Size
Price
Avail.
Qty
Add to cart
S849-100µg
100 µg
$550.00
In stock
S849-500µg
500 µg
$1,950.00
In stock
S849-1.0mg
1.0 mg
$2,600.00
In stock
  

Background

The SARS-CoV-2 Spike (S) Protein consists of the S1 and S2 domains. The S1 subunit contains the N-terminal domain (NTD) and receptor-binding domain (RBD). The S1 subunit recognizes and binds to angiotensin-converting enzyme 2 (ACE2) receptors on target cells through the RBD portion, and subsequent conformational changes in S2 allow for fusion between the viral envelope and host cell membrane. SARS-CoV-2 is closely related to the SARS virus, which was first identified in 2002-20031. Both SARS-CoV and SARS-CoV-2 utilize the ACE2 cell receptor to gain entry into cells, with SARS-CoV-2 binding with higher affinity2. Vaccine and therapeutic development are targeting portions of the spike protein, including the S1 portion3.

Protein Details

Format
Purified No Carrier Protein
Purity
>95% by SDS Page
Endotoxin Level
≤ 1.0 EU/mg as determined by the LAL method
Expression Host
HEK-293
Protein Accession No.
QHD43416.1
Amino Acid Sequence
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSG TNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKV CEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQG NFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLAL HRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKC TLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI ADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQA GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKST NLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP CSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQT RAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGSAS
State of Matter
Sterile Liquid
Predicted Molecular Mass
The predicted molecular mass is ~77 kDa.
Formulation
This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
Storage and Stability
This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.
Shipping
Next Day Ice Pack
NCBI Gene Bank

References & Citations

1. Quinlan et al. bioRxiv: 2020.
2. Wrapp et al. Science: 2020.
3. Tai et al. Nature: 2020.
Elisa Sandwich Protocol
IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
  
Products are for research use only. Not for use in diagnostic or therapeutic procedures.