Recombinant Human CCL5 (RANTES) (50181P)
- -
- -
BackgroundCCL5, also known as Regulated on Activation, Normal T-cell Expressed and Secreted (RANTES), is a proinflammatory chemokine that induces migration and activation of leukocytes, and is also implied in HIV infection. CCL5 binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infections is dependent upon concentration and on the binding of cell surface glycosaminoglycans. Protein DetailsFormat Purified No Carrier Protein Purity >97% Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS State of Matter Lyophilized Predicted Molecular Mass 7.85 kDa Reconstitution Recommended at 100ug/ml in sterile distilled water. Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical ProtocolsMigration assay Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.
