Recombinant Human CXCL12a (SDF-1A) – Biotin

Recombinant Human CXCL12a (SDF-1A) – Biotin

Product No.: 50185PB

- -
- -
Alternate Names
rHuCXCL12a, SDF-1alpha
Product Type
Recombinant Protein
Expression Host
E. coli Cells
Species
Human
Applications
Calcium flux assay

- -
- -
Select Product Size
- -
- -

Background

CXCL12a and CXCL12b, also known as Stromal Cell-Derived Factor 1a and 1b (SDF-1a and SDF-1b), are small cytokines that belong to the intercrine family. Both forms of CXCL12 are produced by alternate splicing of the same gene. CXCL12 is strongly chemotactic for T- lymphocytes and monocytes, and it plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism. It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumor progression. CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12. In breast cancer, however, increased expression of CXCL12 is associated with a reduced risk of distant metastasis. By blocking CXCR4, a major coreceptor for HIV-1 entry, CXCL12 acts as an endogenous inhibitor of CXCR4-tropic HIV-1 strains. CXCL12 was shown to be expressed in many tissues in mice including brain, thymus, heart, lung, liver, kidney, spleen and bone marrow.

Protein Details

Format
Biotin
Purity
>97%
Endotoxin Level
<0.01 EU/µg as determined by the LAL method
Fusion Protein Tag
Biotin at C-Terminal
Amino Acid Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNK
State of Matter
Lyophilized
Predicted Molecular Mass
10.38 kDa
Reconstitution
Recommended at 100ug/ml in sterile distilled water.
Storage and Stability
12 months from date of receipt, -20°C to -70°C, as supplied.
1 month, -20°C to -70°C, under sterile conditions after reconstitution.
We suggest using immediately after reconstitution.
Country of Origin
USA
Shipping
Next Day 2-8°C
Regulatory Status
Research Use Only
Calcium flux assay

Certificate of Analysis

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Disclaimer AlertProducts are for research use only. Not for use in diagnostic or therapeutic procedures.