Recombinant Human ApoE2

Recombinant Human ApoE2

Product No.: A440

- -
- -
Prod. No.A440
Expression Host
HEK-293 Cells

- -
- -
Select Product Size

Data

SDS-PAGE data for ApoE2 Leinco Product Number A440SDS-PAGE
R: 5µg reduced Recombinant Human ApoE2 (Leinco Prod. No.: A440)
NR: 5µg non-reduced Recombinant Human ApoE2 (Leinco Prod. No.: A440)
Western Blot data for ApoE2 Leinco Product Number A440Western Blot
Purified Recombinant ApoE2 (Leinco Prod. No.: A440) was separated on SDS-PAGE under both reducing and non-reducing conditions and probed with an anti-ApoE antibody.
Direct binding of anti-ApoE antibody to Recombinant Human ApoE4 (Leinco Prod. No.: A440) DataDirect binding of anti-ApoE antibody to Recombinant Human ApoE2 (Leinco Prod. No.: A440)
Binding was measured by ELISA. Recombinant Human ApoE2 was immobilized at 1 µg/mL. Anti-ApoE antibody was titrated.
Functional ELISA Data for ApoE2 Leinco Product number A440Functional binding of Recombinant Human VLDLR to Recombinant Human ApoE2 (Leinco Prod. No.: A440)
Binding was measured by ELISA. Recombinant Human VLDLR was immobilized at 1 µg/mL. Recombinant Human ApoE2 protein was titrated. Anti-ApoE antibody was used for detection.
- -
- -

Background

Apolipoprotein E (ApoE) is a 299 amino acid protein, produced by the liver and circulating macrophages, that is a constituent of every plasma lipoprotein except the smallest low density lipoproteins (LDL). It is a key player in the recycling and redistribution of lipids and cholesterol. ApoE is a ligand with a high affinity for low density lipoprotein receptors (LDLR). It regulates the activity of enzymes that metabolize lipids and also make lipids soluble. Mice and humans that lack ApoE cannot remove excess lipoproteins from the plasma and have an increased risk of atherosclerosis. Defective binding of ApoE to its receptors will lead to accumulation of cholesterol-rich lipoprotein particles in the plasma; this is the cause of type III hyperlipoproteinemia. There are three main isoforms of ApoE all products of alleles at a single gene locus: E2 (Cys112, Cys158), E3 (Cys112, Arg158), and E4 (Arg112, Arg158).

Protein Details

Species
Human
Format
Purified No Carrier Protein
Purity
≥90% by SDS PAGE
Endotoxin Level
<1.0 EU/µg
Biological Activity
ELISA binding
Protein Accession No.
P02649
Amino Acid Sequence
MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
State of Matter
Lyophilized
SDS-Page Molecular Weight
35 kDa
Predicted Molecular Mass
34.4 kDa
Formulation
This lyophilized protein is 0.22 µm sterile filtered and lyophilized from 20 mM Sodium Phosphate, pH 7.8 + 0.5 mM DTT.
Reconstitution
Reconstitute at 0.1-1 mg/ml using filtered deionized water. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary.
Storage and Stability
This lyophilized protein is stable for twelve months when stored at -20°C to -70°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at -20°C to -70°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles.
Country of Origin
USA
Shipping
Ambient
Ligand/Receptor
Low-Density Lipoprotein Receptor (LDLR)
Species
Human
Regulatory Status
Research Use Only
NCBI Gene Bank
UniProt.org
P02649
Applications and Recommended Usage ?
(Quality Tested by Leinco)
ELISA,
WB,
FA
Indirect ELISA Protocol
FA
General Western Blot Protocol

Certificate of Analysis

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Disclaimer AlertProducts are for research use only. Not for use in diagnostic or therapeutic procedures.