Recombinant Human CCL27 (CTACK) (50182P)
- -
- -
BackgroundCCL27, also known as Cutaneous T-cell-attracting Chemokine (CTACK) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T-cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CCL27, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior. Protein DetailsFormat Purified No Carrier Protein Purity >97% Product Concentration Lot Specific Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG State of Matter Lyophilized Predicted Molecular Mass 10.149 kDa Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical ProtocolsMigration assay Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
