Recombinant Human CCL3 (MIP-1α) (50187P)

Recombinant Human CCL3 (MIP-1α) (50187P)

Product No.: 50187P

- -
- -
Prod. No.50187P
Expression Host
E. coli Cells

- -
- -
Select Product Size
- -
- -

Background

CCL3, also known as Macrophage Inflammatory Protein-1a (MIP-1a), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Protein Details

Format
Purified No Carrier Protein
Purity
>97%
Product Concentration
Lot Specific
Endotoxin Level
<0.01 EU/µg as determined by the LAL method
Amino Acid Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE EWV​QKYVSDLELSA
State of Matter
Lyophilized
Predicted Molecular Mass
7.716 kDa
Storage and Stability
12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Country of Origin
USA
Shipping
Next Day 2-8°C
Regulatory Status
Research Use Only
Migration assay

Certificate of Analysis

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Disclaimer AlertProducts are for research use only. Not for use in diagnostic or therapeutic procedures.