Recombinant Human CCL4 (MIP-1β) (50191P)

Recombinant Human CCL4 (MIP-1β) (50191P)

Product No.: 50191P

- -
- -
Alternate Names
rHuCCL4, MIP-1beta
Product Type
Recombinant Protein
Expression Host
E. coli Cells
Species
Human
Applications
Migration assay

- -
- -
Select Product Size
- -
- -

Background

CCL4, also known as Macrophage Inflammatory Protein-1beta (MIP-1b) is a small cytokine (~9kDa) that belongs to the CC chemokine family. CCL4 binds to CCR1, CCR2 isoform B, and CCR5. CCL4 is one of the major HIV-suppressive factors produced by CD8+ T-cells; recombinant MIP-1b induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form of MIP-1b (aa 3-69) retains the abilities to induce down-modulation of surface expression of CCR5 and to inhibit CCR5-mediated entry of HIV-1 into T-cells.

Protein Details

Format
Purified No Carrier Protein
Purity
>97%
Product Concentration
Lot Specific
Endotoxin Level
<0.01 EU/µg as determined by the LAL method
Amino Acid Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
State of Matter
Lyophilized
Predicted Molecular Mass
7.818 kDa
Storage and Stability
12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Country of Origin
USA
Shipping
Next Day 2-8°C
Regulatory Status
Research Use Only
Migration assay

Certificate of Analysis

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Disclaimer AlertProducts are for research use only. Not for use in diagnostic or therapeutic procedures.