Recombinant Human CCL4 (MIP-1β) (50191PB) – Biotin
- -
- -
BackgroundCCL4, also known as Macrophage Inflammatory Protein-1beta (MIP-1b) is a small cytokine (~9kDa) that belongs to the CC chemokine family. CCL4 binds to CCR1, CCR2 isoform B, and CCR5. CCL4 is one of the major HIV-suppressive factors produced by CD8+ T-cells; recombinant MIP-1b induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form of MIP-1b (aa 3-69) retains the abilities to induce down-modulation of surface expression of CCR5 and to inhibit CCR5-mediated entry of HIV-1 into T-cells. Protein DetailsFormat Biotin Purity >97% Product Concentration Lot Specific Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN State of Matter Lyophilized Predicted Molecular Mass 10.237 kDa Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical ProtocolsMigration assay Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
