Recombinant Human CXCL10 (IP-10) (50193P)
- -
- -
BackgroundCXCL10, also known as γ-interferon-inducible protein (IP-10), was originally identified as an IFN-gamma-inducible gene in endothelial cells, fibroblasts, and monocytes. IP-10 signals through the CXCR3 receptor to attract Th1 lymphocytes and monocytes. It also has angiostatic and mitogenic properties on vascular smooth muscle cells. A diverse population of cell types rapidly increases transcription of mRNA encoding IP-10, suggesting that IP-10 might be a key mediator of the IFN-gamma response. Protein DetailsFormat Purified No Carrier Protein Purity >97% Product Concentration Lot Specific Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA
IKNLLKAVSKERSKRSP State of Matter Lyophilized Predicted Molecular Mass 8.6 kDa Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical ProtocolsMigration assay Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
