Recombinant Human EGF – Purified No Carrier Protein

Epidermal growth factor (EGF) is a 53-amino-acid cytokine, approximately 6 kDa protein processed from a 1,207-amino-acid precursor (1). EGF binds the EGF receptor (EGFR/ErbB1), a receptor tyrosine kinase, inducing receptor dimerization and trans-autophosphorylation of C-terminal tyrosine residues (4, 5). This phosphorylation recruits signaling adaptors that activate the RAS–MAPK, PI3K–AKT, PLCγ, and STAT pathways, regulating epithelial proliferation, migration, differentiation, and cell survival (5, 6). Because EGFR overexpression and mutation are common in human cancers, the EGF–EGFR axis remains a major focus of oncology research and drug development (6). EGF is also an essential supplement in defined culture media for neural stem cell expansion and epithelial organoids (7, 8).

Asn 971 – Arg 1023, with N-terminal Met MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Lyophilized

This recombinant protein is aseptically packaged (0.2um filtered) and formulated in 0.01 M PBS (phosphate buffered saline) (150 mM NaCl) pH 7.0 - 7.5 with no carrier protein, potassium, calcium or preservatives added before lyophilization.

Reconstitute at 0.1-1.0 mg/mL using filtered deionized water. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary.

This lyophilized protein is stable for twelve months when stored at -20°C to -70°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at -20°C to -70°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles.

Ambient

Research Use Only

P01133

1. Bell G.I. et al. (1986) Nucleic Acids Res. 14:8427–8446.
2. Carpenter G. and Cohen S. (1990) J. Biol. Chem. 265:7709–7712.
3. Harris R.C. et al. (2003) Exp. Cell Res. 284:2–13.
4. Ogiso H. et al. (2002) Cell 110:775–787.
5. Lemmon M.A. and Schlessinger J. (2010) Cell 141:1117–1134.
6. Yarden Y. and Sliwkowski M.X. (2001) Nat. Rev. Mol. Cell Biol. 2:127–137.
7. Reynolds B.A. and Weiss S. (1992) Science 255:1707–1710.
8. Sato T. et al. (2011) Gastroenterology 141:1762–1772.