Recombinant Mouse PD-1
- -
- -
BackgroundMouse Programmed Death-1 (PD-1)is an immune checkpoint receptor that regulates the system encoded by the Pdcd1 gene and functions similarly to its human counterpart. Its primary function involves regulating the immune system by inhibiting T-cell activation. This process is crucial for promoting self-tolerance and minimizing autoimmune reactions. This receptor is primarily found on activated T and B lymphocytes. There are differences between mouse PD-1 and human PD-1 in terms of how they're expressed, regulated, and interact with ligands 1, 2. It is crucial to understand the regulation of PD-1 expression, including the impact of genetic and epigenetic factors, for the development of immune-based therapies1 . Mouse PD-1 is a tool that enables us to study how the immune system is modulated and advance therapies that target the interaction between PD-1 and PD-L1 3 - 6 . Purified Mouse PD-1 Protein can be used for applications such as assays and binding studies, which help us understand how immune checkpoints work and explore potential immunotherapeutic strategies targeting PD-1/PD-L1 interactions7 . By studying mouse models, we can gain insights into treatments for cancer and autoimmune diseases. It's crucial to understand the species-specific differences in PD-1 biology to effectively translate findings from mouse models into human models. Protein DetailsSpecies Mouse Format Purified No Carrier Protein Protein Accession No. Q02242 Amino Acid Sequence LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ State of Matter Lyophilized SDS-Page Molecular Weight 35-45kDA Predicted Molecular Mass ~17kDa Formulation 0.22µm filtered and Lyophilized Reconstitution Reconstitute at 1mg/ml using filtered deionized water. Gently mix by vortexing and/or inversion for 5 minutes or until fully dissolved. Centrifuge if necessary. Storage and Stability 1 month, 2 to 8 °C under sterile conditions after opening and reconstituting. 1 year from date of receipt, -20 to -80 °C as supplied. 3 months from date of receipt, -20 to -80 °C sterile conditions after opening and reconstituting. Country of Origin USA Shipping Ambient Ligand/Receptor PD-L1 Species Mouse Regulatory Status Research Use Only NCBI Gene Bank UniProt.org Applications and Recommended Usage ? (Quality Tested by Leinco) SDS-PAGE, WB, ELISA, FA References & Citations1. Bally APR, Austin JW, Boss JM. The Journal of Immunology. 2016;196(6):2431-2437. 2. Cheng X, Veverka V, Radhakrishnan A, et al. Journal of Biological Chemistry. 2013;288(17):11771-11785. 3. Salmaninejad A, Valilou SF, Shabgah AG, et al. J Cell Physiol. 2019;234(10):16824-16837. 4. Dermani FK, Samadi P, Rahmani G, Kohlan AK, Najafi R. Journal of Cellular Physiology. 2019;234(2):1313-1325. 5. McDermott DF, Atkins MB. Cancer Medicine. 2013;2(5):662-673. 6. Zitvogel L, Kroemer G. OncoImmunology. 2012;1(8):1223-1225. 7. Liu D, Wang S, Bindeman W. Journal of Hematology & Oncology. 2017;10(1):110. Technical ProtocolsCertificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.
