Recombinant Human CCL27 (CTACK) (50182P)

CCL27, also known as Cutaneous T-cell-attracting Chemokine (CTACK) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T-cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CCL27, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior.

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Lyophilized

10.149 kDa

12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.

Next Day 2-8°C

Research Use Only