Recombinant Human CCL3 (MIP-1α) (50187PB) – Biotin

CCL3, also known as Macrophage Inflammatory Protein-1a (MIP-1a), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE EWV​QKYVSDLELSA

Lyophilized

10.135 kDa

12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.

Next Day 2-8°C

Research Use Only