Recombinant Human CCL5 (RANTES) (50181P)

Product No.: 50181P


Alternate Names rHuCCL5 Product Type Recombinant Protein Expression Host E. coli Cells Species Human Applications Migration assay


Select Product Size 5 µg — $75.00 100 µg — $551.00 1 mg — $2,503.00 20 µg — $159.00 50 µg — $350.00	Qty Max: Min: 1 Step: 1 Select A Size ADD TO CART Login For mAb Advantage Pricing Contact Us for Bulk Quantities


Background CCL5, also known as Regulated on Activation, Normal T-cell Expressed and Secreted (RANTES), is a proinflammatory chemokine that induces migration and activation of leukocytes, and is also implied in HIV infection. CCL5 binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infections is dependent upon concentration and on the binding of cell surface glycosaminoglycans. Protein Details Format Purified No Carrier Protein Purity >97% Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS State of Matter Lyophilized Predicted Molecular Mass 7.85 kDa Reconstitution Recommended at 100ug/ml in sterile distilled water. Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical Protocols Migration assay Certificate of Analysis Request COA IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.

Background

CCL5, also known as Regulated on Activation, Normal T-cell Expressed and Secreted (RANTES), is a proinflammatory chemokine that induces migration and activation of leukocytes, and is also implied in HIV infection. CCL5 binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infections is dependent upon concentration and on the binding of cell surface glycosaminoglycans.

Protein Details

Format

Purified No Carrier Protein

Purity

>97%

Endotoxin Level

<0.01 EU/µg as determined by the LAL method

Amino Acid Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

State of Matter

Lyophilized

Predicted Molecular Mass

7.85 kDa

Reconstitution

Recommended at 100ug/ml in sterile distilled water.

Storage and Stability

12 months from date of receipt, -20°C to -70°C, as supplied.
1 month, 2°C to 8°C, under sterile conditions after reconstitution.
3 months, -20°C to -70°C, under sterile conditions after reconstitution.

Country of Origin

USA

Shipping

Next Day 2-8°C

Regulatory Status

Research Use Only

Migration assay

Certificate of Analysis

Request COA

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.

Products are for research use only. Not for use in diagnostic or therapeutic procedures.

NEW Products!

Recombinant Human CCL5 (RANTES) (50181P)