Recombinant Monkeypox (Zaire79) A35R
- -
- -
BackgroundMonkeypox virus (MPXV) is a zoonotic member of the Orthopoxvirus genus in the Poxviridae family1. Monkeypox has gained clinical relevance due to the eradication of smallpox1,2. Loss of immunity to smallpox in human populations, via infection or vaccination, has created opportunities for increased monkeypox prevalence and viral mutations that may affect virulence1,2. An infection with one orthopoxvirus of any one species, or vaccinia virus (VACV) vaccination, protects against infection by other orthopoxviruses3,4,5. MPXV is an enveloped virus with a linear, double-stranded DNA genome2 and a large, complex proteome of over 200 proteins6. During infection, the virus exists in two antigenically distinct forms: mature virions (MV) or enveloped virions (EV)6. A35R is an ortholog of VACV A33R, which encodes a type II integral membrane protein present as a dimer on EV7. A33R is a target of immunotherapeutics and has been identified as a protective target of subunit vaccines delivered as DNA or protein. Antibodies against A33R, such as monoclonal antibody MAb-1G10, which protects animals from lethal challenge with VACV strain WR, are protective in vivo8. However, MAb-1G10 binds poorly to recombinant A35R in radiolabeled immunoprecipitation analysis and ELISA assays as well as to authentic A35R protein expressed in MPXV-infected cells, unless mutated to match the VACV peptide at positions 117, 118, and 1207. S118L and E120S substitutions and double changes at K117Q/S118L and S118L/E120S can also rescue MAb-1G10 interaction with A35R. Additionally, MAb-1G10 can interact with other A33 orthopoxvirus orthologs that are identical to VACV at amino acids 118 and 120, demonstrating a critical role for these amino acids in MAb-1G10 binding. Furthermore, serum antibodies from mice vaccinated with A33R (VACV) DNA improved when positions 117, 118, and 120 of A35R (MPXV) were changed to those of A33R, indicating a role in protective immunity for this region of A33. There are eight amino acid substitutions between the A33R (VACV) and A35R (MPXV) orthologs7. Additionally, A35R (MPXV) is truncated by four amino acids at the carboxy terminus. Binding to MAb-1G10 is not rescued by changes to the carboxy terminus. Protein DetailsSpecies Viral Format Purified No Carrier Protein Protein Accession No. NP_536572.1 Amino Acid Sequence RLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQG
SCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNP
ITKTTSDYQDSDVSQEVRKYFCT N-terminal Sequence Analysis NP State of Matter Lyophilized Predicted Molecular Mass 14 kDa Storage and Stability This lyophilized protein is stable for twelve months when stored at -20°C to -70°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at -20°C to -70°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Ambient Species Viral Regulatory Status Research Use Only UniProt.org Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA, WB References & Citations 1 Sklenovská N, Van Ranst M. Front Public Health. 6:241. 2018. 2 Moore M, Zahra F. 2021 Oct 19. In: StatPearls [Internet]. Treasure Island (FL): StatPearls Publishing; 2022 Jan–. 3 McConnell S, Herman YF, Mattson DE, et al. Am J Vet Res. 25:192-195. 1964. 4 Hammarlund E, Lewis MW, Carter SV, et al. Nat Med. 11(9):1005-1011. 2005. 5 Gilchuk I, Gilchuk P, Sapparapu G, et al. Cell. 167(3):684-694.e9. 2016. 6 Moss B. Immunol Rev. 239:8–26. 2011. 7 Golden JW, Hooper JW. Virology. 377(1):19-29. 2008. 8 Lustig S, Fogg C, Whitbeck JC, et al. J. Virol. 79(21):13454–13462. 2005. Technical ProtocolsCertificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.