Recombinant Monkeypox (Zaire79) B6R

Monkeypox virus (MPXV) is a zoonotic member of the Orthopoxvirus genus in the Poxviridae family¹. Monkeypox has gained clinical relevance due to the eradication of smallpox^1,2. Loss of immunity to smallpox in human populations, via infection or vaccination, has created opportunities for increased monkeypox prevalence and viral mutations that may affect virulence^1,2. An infection with one orthopoxvirus of any one species, or vaccinia virus (VACV) vaccination, protects against infection by other orthopoxviruses^3,4,5. MPXV is an enveloped virus with a linear, double-stranded DNA genome² and a large, complex proteome of over 200 proteins⁶.

B6R, a MPXV glycoprotein known to elicit a neutralizing antibody response in vaccinated animals, was selected as a candidate antigen for vaccination in mice⁷. B6R was amplified from DNA of MPXV strain V79-I-005 and delivered by a BoHV-4 vector using BEK and BEKcre cells. The 129 stat1 ^-/- murine MPXV model was used in the lethal challenge. B6R conferred protection against weight loss but did not protect against mortality.

MPXV B6R is orthologous to VACV B5R antigen 8 . B5R is a 42 kDa glycoprotein found on the viral surface involved in cell surface glycosaminoglycan-mediated disruption of the viral outer membrane^9,10,11.

Viral

QNP13760.1

TCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYE NPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTS WNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSY ISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSP SSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIE SLE

NP

Lyophilized

14-21 kDa

14 kDa

This lyophilized protein is stable for twelve months when stored at -20°C to -70°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at -20°C to -70°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles.

Ambient

Viral

Research Use Only

1 Sklenovská N, Van Ranst M. Front Public Health. 6:241. 2018.
2 Moore M, Zahra F. 2021 Oct 19. In: StatPearls [Internet]. Treasure Island (FL):StatPearls Publishing; 2022 Jan–.
3 McConnell S, Herman YF, Mattson DE, et al. Am J Vet Res. 25:192-195. 1964.
4 Hammarlund E, Lewis MW, Carter SV, et al. Nat Med. 11(9):1005-1011. 2005.
5 Gilchuk I, Gilchuk P, Sapparapu G, et al. Cell. 167(3):684-694.e9. 2016.
6 Moss B. Immunol Rev. 239:8–26. 2011.
7 Franceschi V, Parker S, Jacca S, et al. PLoS Negl Trop Dis. 9(6):e0003850. 2015.
8 Gong Q, Wang C, Chuai X, et al. Virol Sin. 37(4):477-482. 2022.
9 Engelstad M, Smith GL. Virology. 194: 627–637. 1993.
10 Isaacs SN, Wolffe EJ, Payne LG, et al. J Virol. 66: 7217–7224. 1992.
11 Law M, Carter GC, Roberts KL, et al. Proc Natl Acad Sci U S A 103: 5989–5994.2006.