Recombinant Monkeypox (Zaire79) B6R
- -
- -
BackgroundMonkeypox virus (MPXV) is a zoonotic member of the Orthopoxvirus genus in the Poxviridae family1. Monkeypox has gained clinical relevance due to the eradication of smallpox1,2. Loss of immunity to smallpox in human populations, via infection or vaccination, has created opportunities for increased monkeypox prevalence and viral mutations that may affect virulence1,2. An infection with one orthopoxvirus of any one species, or vaccinia virus (VACV) vaccination, protects against infection by other orthopoxviruses3,4,5. MPXV is an enveloped virus with a linear, double-stranded DNA genome2 and a large, complex proteome of over 200 proteins6. B6R, a MPXV glycoprotein known to elicit a neutralizing antibody response in vaccinated animals, was selected as a candidate antigen for vaccination in mice7. B6R was amplified from DNA of MPXV strain V79-I-005 and delivered by a BoHV-4 vector using BEK and BEKcre cells. The 129 stat1 -/- murine MPXV model was used in the lethal challenge. B6R conferred protection against weight loss but did not protect against mortality. MPXV B6R is orthologous to VACV B5R antigen 8 . B5R is a 42 kDa glycoprotein found on the viral surface involved in cell surface glycosaminoglycan-mediated disruption of the viral outer membrane9,10,11. Protein DetailsSpecies Viral Format Purified No Carrier Protein Protein Accession No. QNP13760.1 Amino Acid Sequence TCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYE
NPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTS
WNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSY
ISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSP
SSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIE
SLE N-terminal Sequence Analysis NP State of Matter Lyophilized SDS-Page Molecular Weight 14-21 kDa Predicted Molecular Mass 14 kDa Storage and Stability This lyophilized protein is stable for twelve months when stored at -20°C to -70°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at -20°C to -70°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Ambient Species Viral Regulatory Status Research Use Only NCBI Gene Bank Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA, WB References & Citations1 Sklenovská N, Van Ranst M. Front Public Health. 6:241. 2018. 2 Moore M, Zahra F. 2021 Oct 19. In: StatPearls [Internet]. Treasure Island (FL):StatPearls Publishing; 2022 Jan–. 3 McConnell S, Herman YF, Mattson DE, et al. Am J Vet Res. 25:192-195. 1964. 4 Hammarlund E, Lewis MW, Carter SV, et al. Nat Med. 11(9):1005-1011. 2005. 5 Gilchuk I, Gilchuk P, Sapparapu G, et al. Cell. 167(3):684-694.e9. 2016. 6 Moss B. Immunol Rev. 239:8–26. 2011. 7 Franceschi V, Parker S, Jacca S, et al. PLoS Negl Trop Dis. 9(6):e0003850. 2015. 8 Gong Q, Wang C, Chuai X, et al. Virol Sin. 37(4):477-482. 2022. 9 Engelstad M, Smith GL. Virology. 194: 627–637. 1993. 10 Isaacs SN, Wolffe EJ, Payne LG, et al. J Virol. 66: 7217–7224. 1992. 11 Law M, Carter GC, Roberts KL, et al. Proc Natl Acad Sci U S A 103: 5989–5994.2006. Technical ProtocolsCertificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.