Recombinant Chikungunya Envelope Protein E2 (Strain SL-CK1)

Recombinant Chikungunya Envelope Protein E2 (strain SL-CK1)

Product No.: C446


Alternate Names CHIK, CHIKV, Envelope protein, Envelope protein 2, Envelope protein E2, E2 protein, E2 Product Type Recombinant Protein Expression Host HEK-293 Cells Applications ELISA ⋅ WB


Select Product Size 500 µg — $1,300.00 100 µg — $305.00	Qty Max: Min: 1 Step: 1 Select A Size ADD TO CART Login For mAb Advantage Pricing Contact Us for Bulk Quantities

Data

SDS Page of Recombinant Chikungunya E2 protein Leinco Prod. No.: C446

SDS-PAGE
R: 5µg reduced Recombinant Chikungunya E2 protein, (Leinco Prod. No.: C446)

Purified Recombinant Chikungunya E2 protein western blot data Leinco Prod. No.: C446

Western Blot
Purified Recombinant Chikungunya E2 protein (Leinco Prod. No.: C446) was separated on SDS-PAGE under reducing conditions and probed with an anti-Chikungunya E2 antibody (Leinco Prod. No.: LT569).

Direct binding of Chikungunya E2 antibody - Leinco Prod. No.: C446

Direct binding of Recombinant anti-Chikungunya E2 antibody (Leinco Prod. No.: LT569) to Chikungunya E2 protein (Leinco Prod. No.: C446).
Binding was measured by ELISA. Chikungunya E2 was immobilized at 1 µg/mL. Anti-Chikungunya E2 antibody was titrated.

Sandwich ELISA binding of Chikungunya E2 Protein Leinco Prod. No.: C446

Sandwich ELISA binding of Anti-Chikungunya E2 antibody clone 35 (Leinco Prod. No.: LT569) to Recombinant Chikungunya E2 protein (Leinco Prod. No.: C446).
Binding was measured by Sandwich ELISA. Anti-Chikungunya E2 antibody clone 35, capture reagent, was immobilized at 1 µg/mL. Chikungunya E2 protein was titrated. Anti-Chikungunya E2 antibody clone 35 (Leinco Prod. No.: LT569), detection reagent, was diluted to 1ug/mL.


Background Chikungunya virus (CHIKV) is a mosquito-transmitted alphavirus that causes epidemics globally and has been declared a notable disease by the Centers for Disease Control and Prevention^{1, 2}. Symptoms include high fever, myalgia, rash, and severe polyarthritis which can persist for long after acute infection. CHIKV is an enveloped virus with an 11.8-kb single-stranded, positive-sense RNA genome with two open reading frames^{3, 4}. There are three main genotypes, having 95.2 to 99.8% amino acid identity: Asian, West African, and East/Central/South African (ECSA). The mature CHIKV virion is comprised of a nucleocapsid protein C and two glycoproteins, E1 and E2 5. E1 participates in virus fusion. E2 functions in attachment to cells. E1 and E2 form 80 trimeric spikes on the virus surface⁶. E2 localizes to the top of the spike and contains three domains: N-terminal domain A (center), domain B (tip), and C-terminal domain C (proximal to the viral membrane)⁵. The SL-CK1 CHIKV strain was isolated from an epidemic in Sri Lanka in 2007 from a human source and has been fully sequenced (Genbank ID HM045801.1)⁷. Residue 18 of strain SL-CK1 E2 is a histidine⁸. This residue is an important determinant of virus fitness in mosquito cells. Soluble recombinant CHIKV E2 protein has been used to generate monoclonal antibodies⁵. Protein Details Species Viral Format Purified No Carrier Protein Purity ≥90% by SDS PAGE Endotoxin Level <1.0 EU/µg Protein Accession No. H1ZYM0, H1ZYM0-CHIKV Amino Acid Sequence stkdnfnvykatrpylahcpdcgeghschspvalerirneatdgtlkiqvslqigiktddshdwtklrymdnhmpadaeraglfvrtsapctitgtmghfilarcpkgetltvgftdsrkishscthpfhhdppvigrekfhsrpqhgkelpcstyvqstaatteeievhmppdtpdrtlmsqqsgnvkitvngqtvrykcncggsnegltttdkvinnckvdqchaavtnhkkwqynsplvprnaelgdrkgkihipfplanvtcrvpkarnptvtygknqvimllypdhptllsyrnmgeepnyqeewvmhkkevvltvpteglevtwgnnepykywpq N-terminal Sequence Analysis NP State of Matter Lyophilized SDS-Page Molecular Weight 47 kDa Predicted Molecular Mass 47 kDa Formulation Lyophilized from 0.01M Phosphate Buffered Saline (150mM NaCl)(PBS) pH 7.4, with 5% Trehalose and 10mM DTT Reconstitution Reconstitute at 1mg/ml using filtered 1x PBS. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary. Storage and Stability 1 month, 2 to 8 °C. Sterile conditions after opening and reconstitution. 1 year from date of receipt, -20 to -80 °C as supplied 3 months from date of receipt, -20 to -80 °C. Sterile conditions after opening and reconstitution. Country of Origin USA Shipping Ambient Ligand/Receptor Ligand Species Viral Regulatory Status Research Use Only NCBI Gene Bank HM045801.1 UniProt.org H1ZYM0 Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA, Western Blot References & Citations 1. Barrera, R., Hunsperger, E., Lanciotti, RS. et al. Preparedness and response for chikungunya virus introduction in the Americas. Pan American Health Organization; National Center for Emerging and Zoonotic Infectious Diseases (U.S.). Division of Vector-Borne Diseases. 2011. 2. Silva, JVJ Jr., Ludwig-Begall, LF., Oliveira-Filho, EF. et al. Acta Trop. 188:213-224. 2018. 3. Powers, AM., Brault, AC., Tesh, RB. et al. J. Gen. Virol. 81:471–479. 2000. 4. Arankalle, VA., Shrivastava, S., Cherian, S. et al. J. Gen. Virol. 88:1967–1976. 2007. 5. Pal, P., Dowd, KA., Brien, JD. et al. PLoS Pathog. 9(4):e1003312. 2013. 6. Mukhopadhyay, S., Zhang, W., Gabler, S. et al. Structure. 14(1):63-73. 2006. 7. Volk SM, Chen R, Tsetsarkin KA, et al. J Virol. 84(13):6497-504. 2010. 8. Jupille HJ, Medina-Rivera M, Hawman DW, et al. J Virol. 87(10):5970-84. 2013. View product citations for antibody PRODUCT_CODE on CiteAb Technical Protocols Certificate of Analysis Request COA IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.

Background

Chikungunya virus (CHIKV) is a mosquito-transmitted alphavirus that causes epidemics globally and has been declared a notable disease by the Centers for Disease Control and Prevention^{1, 2}. Symptoms include high fever, myalgia, rash, and severe polyarthritis which can persist for long after acute infection. CHIKV is an enveloped virus with an 11.8-kb single-stranded, positive-sense RNA genome with two open reading frames^{3, 4}. There are three main genotypes, having 95.2 to 99.8% amino acid identity: Asian, West African, and East/Central/South African (ECSA). The mature CHIKV virion is comprised of a nucleocapsid protein C and two glycoproteins, E1 and E2 5. E1 participates in virus fusion. E2 functions in attachment to cells. E1 and E2 form 80 trimeric spikes on the virus surface⁶. E2 localizes to the top of the spike and contains three domains: N-terminal domain A (center), domain B (tip), and C-terminal domain C (proximal to the viral membrane)⁵.

The SL-CK1 CHIKV strain was isolated from an epidemic in Sri Lanka in 2007 from a human source and has been fully sequenced (Genbank ID HM045801.1)⁷. Residue 18 of strain SL-CK1 E2 is a histidine⁸. This residue is an important determinant of virus fitness in mosquito cells.

Soluble recombinant CHIKV E2 protein has been used to generate monoclonal antibodies⁵.

Protein Details

Species

Viral

Format

Purified No Carrier Protein

Purity

≥90% by SDS PAGE

Endotoxin Level

<1.0 EU/µg

Protein Accession No.

H1ZYM0, H1ZYM0-CHIKV

Amino Acid Sequence

stkdnfnvykatrpylahcpdcgeghschspvalerirneatdgtlkiqvslqigiktddshdwtklrymdnhmpadaeraglfvrtsapctitgtmghfilarcpkgetltvgftdsrkishscthpfhhdppvigrekfhsrpqhgkelpcstyvqstaatteeievhmppdtpdrtlmsqqsgnvkitvngqtvrykcncggsnegltttdkvinnckvdqchaavtnhkkwqynsplvprnaelgdrkgkihipfplanvtcrvpkarnptvtygknqvimllypdhptllsyrnmgeepnyqeewvmhkkevvltvpteglevtwgnnepykywpq

N-terminal Sequence Analysis

State of Matter

Lyophilized

SDS-Page Molecular Weight

47 kDa

Predicted Molecular Mass

47 kDa

Formulation

Lyophilized from 0.01M Phosphate Buffered Saline (150mM NaCl)(PBS) pH 7.4, with 5% Trehalose and 10mM DTT

Reconstitution

Reconstitute at 1mg/ml using filtered 1x PBS. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary.

Storage and Stability

1 month, 2 to 8 °C. Sterile conditions after opening and reconstitution. 1 year from date of receipt, -20 to -80 °C as supplied 3 months from date of receipt, -20 to -80 °C. Sterile conditions after opening and reconstitution.

Country of Origin

USA

Shipping

Ambient

Ligand/Receptor

Ligand

Species

Viral

Regulatory Status

Research Use Only

NCBI Gene Bank

HM045801.1

UniProt.org

H1ZYM0

Applications and Recommended Usage ?
(Quality Tested by Leinco)

ELISA,
Western Blot

References & Citations

1. Barrera, R., Hunsperger, E., Lanciotti, RS. et al. Preparedness and response for chikungunya virus introduction in the Americas. Pan American Health Organization; National Center for Emerging and Zoonotic Infectious Diseases (U.S.). Division of Vector-Borne Diseases. 2011.
2. Silva, JVJ Jr., Ludwig-Begall, LF., Oliveira-Filho, EF. et al. Acta Trop. 188:213-224. 2018.
3. Powers, AM., Brault, AC., Tesh, RB. et al. J. Gen. Virol. 81:471–479. 2000.
4. Arankalle, VA., Shrivastava, S., Cherian, S. et al. J. Gen. Virol. 88:1967–1976. 2007.
5. Pal, P., Dowd, KA., Brien, JD. et al. PLoS Pathog. 9(4):e1003312. 2013.
6. Mukhopadhyay, S., Zhang, W., Gabler, S. et al. Structure. 14(1):63-73. 2006.
7. Volk SM, Chen R, Tsetsarkin KA, et al. J Virol. 84(13):6497-504. 2010.
8. Jupille HJ, Medina-Rivera M, Hawman DW, et al. J Virol. 87(10):5970-84. 2013.

View product citations for antibody PRODUCT_CODE on CiteAb