Streptavidin Protein

Recombinant Streptavidin – Purified No Carrier Protein

Product No.: S204


Product Type Recombinant Protein Expression Host E. coli Cells Applications ELISA ⋅ FC ⋅ IF ⋅ IHC ⋅ IP ⋅ WB


Select Product Size 25 mg — $325.00 100 mg — $495.00	Qty Max: Min: 1 Step: 1 Select A Size ADD TO CART Login For mAb Advantage Pricing Contact Us for Bulk Quantities


Background Streptavidin is a biotin binding protein present in the fermentation broth of the bacterium Streptomyces avidinii. Each molecule of streptavidin can bind four molecules of biotin with a high affinity constant (K_d~10^-15). Unlike native avidin, streptavidin is not glycosylated and has a near neutral isoelectric point (pI ~ 5-6) vs a pI of 10 for native avidin. Protein Details Species Human Format Purified Purity ≥95% by SDS Page Amino Acid Sequence DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ State of Matter Lyophilized Predicted Molecular Mass 55 kDa Formulation Lyophilized from 0.01M PBS, pH 7.2-7.4, 150mM NaCl with no carrier protein, calcium, potassium or preservatives added. Reconstitution Reconstitute in highly pure deionized water to 1 mg/ml. Gently mix by vortexing and/or inversion for 5 minutes or until fully dissolved. Centrifuge if necessary. Storage and Stability The lyophilized streptavidin is stable for at least one year from date of receipt when stored at -20°C to -80°C. Reconstituted streptavidin is stable for 3 months from date of reconstitution when stored at -20°C to -80°C. Store in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Next Day 2-8°C Ligand/Receptor Biotin Species Human Regulatory Status Research Use Only UniProt.org P22629 Technical Protocols IF Certificate of Analysis Request COA IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.

Background

Streptavidin is a biotin binding protein present in the fermentation broth of the bacterium Streptomyces avidinii. Each molecule of streptavidin can bind four molecules of biotin with a high affinity constant (K_d~10^-15). Unlike native avidin, streptavidin is not glycosylated and has a near neutral isoelectric point (pI ~ 5-6) vs a pI of 10 for native avidin.

Protein Details

Species

Human

Format

Purified

Purity

≥95% by SDS Page

Amino Acid Sequence

DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

State of Matter

Lyophilized

Predicted Molecular Mass

55 kDa

Formulation

Lyophilized from 0.01M PBS, pH 7.2-7.4, 150mM NaCl with no carrier protein, calcium, potassium or preservatives added.

Reconstitution

Reconstitute in highly pure deionized water to 1 mg/ml. Gently mix by vortexing and/or inversion for 5 minutes or until fully dissolved. Centrifuge if necessary.

Storage and Stability

The lyophilized streptavidin is stable for at least one year from date of receipt when stored at -20°C to -80°C. Reconstituted streptavidin is stable for 3 months from date of reconstitution when stored at -20°C to -80°C. Store in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles.

Country of Origin

USA

Shipping

Next Day 2-8°C

Ligand/Receptor

Biotin

Species

Human

Regulatory Status

Research Use Only

UniProt.org

P22629