Recombinant Influenza A Nucleocapsid

Home/Recombinant Proteins/Recombinant Influenza A Nucleocapsid

Pricing & Details

Product. No.F600
Alternate Names
Common flu NP, Influenza A virus NP, NP, Nucleocapsid protein, Nucleoprotein, Protein N, Seasonal Influenza A (H1N1) Nucleocapsid Protein
Expression Host
HEK-293
Species
Influenza A Virus
Virus
Prod No.
Size
Price
Avail.
Qty
Add to cart
F600-100 µg
100 µg
$350.00
In stock
Max:
Min: 1
Step: 1
F600-500 µg
500 µg
$1,450.00
In stock
Max:
Min: 1
Step: 1
F600-1 mg
1 mg
$2,300.00
In stock
Max:
Min: 1
Step: 1
Bulk quantities available. Contact us for pricing.

Background

There are four types of Influenza (flu) viruses: type A, B, C, and D. Influenza A and B viruses are routinely spread in people and other mammals, while also known for seasonal flu epidemics each year. Influenza A is the genus Alphainfluenzavirus of the virus family Orthomyxoviridae. Influenza A is classified into two main protein subtypes, hemagglutinin (HA) and neuraminidase (NA), located on the surface of the virus. Breaking down the proteins further, there are 18 hemagglutinin subtypes and 11 different neuraminidase subtypes1. Influenza A can be even further classified into specific clades (also known as groups) and sub-clades (also known as sub-groups) based on similarity of their HA/NA gene sequences1. The Nucleocapsid protein or nucleoprotein (NP) of the influenza virus A negative-strand RNA’s primary function is to encapsulate the virus genome for the purpose of RNA transcription, replication and packaging2. Specifically, NP is the most abundant viral protein in infected cells2, therefore the NP can be and has been used for anti-influenza drug development3 The NP of influenza A and B viruses share up to 38% of their amino acid sequence, indicating region functionality differences at the amino acid level4

Protein Details

Format
Purified No Carrier Protein
Purity
≥95% by SDS Page
Product Concentration
≥ 5.0 mg/ml
Endotoxin Level
<0.10 EU per 1 μg of the protein by the LAL method
Expression Host
HEK-293
Protein Accession No.
Amino Acid Sequence
MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNS LTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELVLYDKEEIRRIW RQANNGDDATAGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG AAVKGVGTMVMELIRMIKRGINDRNFWRGENGRKTRSAYERMCNILKGKFQTAAQRAMMD QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEKEGYSLVG IDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACNSAAFEDLRVLSFIRGTKVSPRGKLST RGVQIASNENMDAMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPAFSVQRNLPF DKPTIMAAFTGNTEGRTSDMRAEIIRMMEGAKPEEMSFQGRGVFELSDEKAANPIVPSFD MSNEGSYFFGDNAEEYDN
State of Matter
Sterile Liquid
Predicted Molecular Mass
The predicted molecular mass is ~59 kDa.
Formulation
This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
Storage and Stability
This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.
Country of Origin
USA
Shipping
Next Day Ice Pack
NCBI Gene Bank

References & Citations

1. Types of Influenza viruses (2019) Center for Disease Control and Prevention.
2. Hu Y, Sneyd H, et al. (2017) Curr Top med Chem. 2017; 17(20): 2271–2285.
3. Portela A, Digard P. (2012) J. Gen Virol. 2002 Apr;83(Pt 4):723-734.
4. Sherry L, Smith M, et al. (2014) Journal of Virology. 2014; 88(21); 12326-12338. DOI https://doi.org/10.1128/JVI.01542-14
IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Products are for research use only. Not for use in diagnostic or therapeutic procedures.
Leinco Technologies uses cookies to improve your experience and our website service. By continuing to browse our website, you accept our cookie policy. Ok