Recombinant Mouse ApoE — Purified No Carrier Protein

Apolipoprotein (APO) E is a sialylated glycoprotein¹ that functions in lipid metabolism, neurobiology, and neurodegenerative diseases² by playing an important role in plasma cholesterol metabolism³. Functional roles of APOE include lipoprotein production, conversion, clearance, and transport between organs via plasma and interstitial fluids¹.

As a core component of plasma lipoproteins, APOE interacts with both the lipoprotein particle core as well as the plasma aqueous environment¹. APOE binds to many molecules including high-density lipoproteins (HDL), chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL), intermediate density lipoproteins (IDL), and receptors such as LDL receptor/LDLR and very low-density lipoprotein receptor/VLDLR. APOE also binds heparan- sulfate proteoglycans on cell surfaces.

APOE is synthesized in mouse peritoneal macrophages³, mid-gestation mouse embryos, visceral yolk sacs as well as virtually all adult peripheral tissue in rodents⁴ and is secreted into the extracellular space and matrix¹. APOE knockout mice display severe hypercholesterolemia, have impaired clearance of dietary fats, and are prone to atherosclerosis. The mouse APOE homolog was isolated from a genomic library³ and is located on chromosome 7¹. Unlike human APOE, which has three major alleles (ε2, ε3, and ε4), with ε4 implicated in risk of Alzheimer’s Disease and ε2 implicated in protection⁵, APOE expression in mouse is constrained to a single allele¹.

Mouse

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDADDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMH RQWANLMEKIQASVATNPIITPVAQE

NP

Lypholized

34 kDa

Reconstitute at 0.1-1 mg/ml using filtered deionized water. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary.

This lyophilized protein is stable for twelve months when stored at -20°C to -80°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at -20°C to -80°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles.

Ambient

Mouse

Research Use Only

TBD

1. https://www.uniprot.org/uniprotkb/P08226/entry
2. Huang Y, Mahley RW. Neurobiol Dis. 72 Pt A:3-12. 2014.
3. Horiuchi K, Tajima S, Menju M, et al. J Biochem. 106(1):98-103. 1989.
4. Basheeruddin K, Stein P, Strickland S, et al. Proc Natl Acad Sci U S A. 84(3):709-713. 1987.
5. Serrano-Pozo A, Das S, Hyman BT. Lancet Neurol. 20(1):68-80. 2021.