Recombinant Mouse ApoE — Purified No Carrier Protein
Recombinant Mouse ApoE — Purified No Carrier Protein
Product No.: A540
- -
- -
| Alternate Names Apolipoprotein E Product Type Recombinant Protein Expression Host E. coli Cells Species Mouse Applications ELISA ⋅ FA ⋅ WB ⋅ SDS-PAGE |
- -
- -
| Select Product Size | Qty Max: Min: 1 Step: 1 Select A Size |
- -
- -
BackgroundApolipoprotein (APO) E is a sialylated glycoprotein1 that functions in lipid metabolism, neurobiology, and neurodegenerative diseases2 by playing an important role in plasma cholesterol metabolism3. Functional roles of APOE include lipoprotein production, conversion, clearance, and transport between organs via plasma and interstitial fluids1. As a core component of plasma lipoproteins, APOE interacts with both the lipoprotein particle core as well as the plasma aqueous environment1. APOE binds to many molecules including high-density lipoproteins (HDL), chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL), intermediate density lipoproteins (IDL), and receptors such as LDL receptor/LDLR and very low-density lipoprotein receptor/VLDLR. APOE also binds heparan- sulfate proteoglycans on cell surfaces. APOE is synthesized in mouse peritoneal macrophages3, mid-gestation mouse embryos, visceral yolk sacs as well as virtually all adult peripheral tissue in rodents4 and is secreted into the extracellular space and matrix1. APOE knockout mice display severe hypercholesterolemia, have impaired clearance of dietary fats, and are prone to atherosclerosis. The mouse APOE homolog was isolated from a genomic library3 and is located on chromosome 71. Unlike human APOE, which has three major alleles (ε2, ε3, and ε4), with ε4 implicated in risk of Alzheimer’s Disease and ε2 implicated in protection5, APOE expression in mouse is constrained to a single allele1. Protein DetailsSpecies Mouse Format Purified No Carrier Protein Amino Acid Sequence EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDADDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMH RQWANLMEKIQASVATNPIITPVAQE N-terminal Sequence Analysis NP State of Matter Lypholized Predicted Molecular Mass 34 kDa Reconstitution Reconstitute at 0.1-1 mg/ml using filtered deionized water. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary. Storage and Stability This lyophilized protein is stable for twelve months when stored at -20°C to -80°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at -20°C to -80°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Ambient Species Mouse Regulatory Status Research Use Only NCBI Gene Bank UniProt.org Applications and Recommended Usage ? (Quality Tested by Leinco) SDS-Page, WB, ELISA, Functional Assay Other Applications Reported In Literature ? TBD References & Citations1. https://www.uniprot.org/uniprotkb/P08226/entry 2. Huang Y, Mahley RW. Neurobiol Dis. 72 Pt A:3-12. 2014. 3. Horiuchi K, Tajima S, Menju M, et al. J Biochem. 106(1):98-103. 1989. 4. Basheeruddin K, Stein P, Strickland S, et al. Proc Natl Acad Sci U S A. 84(3):709-713. 1987. 5. Serrano-Pozo A, Das S, Hyman BT. Lancet Neurol. 20(1):68-80. 2021. Technical ProtocolsCertificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.
