Recombinant Mouse PD-1

Mouse Programmed Death-1 (PD-1)is an immune checkpoint receptor that regulates the system encoded by the Pdcd1 gene and functions similarly to its human counterpart. Its primary function involves regulating the immune system by inhibiting T-cell activation. This process is crucial for promoting self-tolerance and minimizing autoimmune reactions. This receptor is primarily found on activated T and B lymphocytes.

There are differences between mouse PD-1 and human PD-1 in terms of how they're expressed, regulated, and interact with ligands ^{1, 2}. It is crucial to understand the regulation of PD-1 expression, including the impact of genetic and epigenetic factors, for the development of immune-based therapies¹ .

Mouse PD-1 is a tool that enables us to study how the immune system is modulated and advance therapies that target the interaction between PD-1 and PD-L1 ^{3 - 6} . Purified Mouse PD-1 Protein can be used for applications such as assays and binding studies, which help us understand how immune checkpoints work and explore potential immunotherapeutic strategies targeting PD-1/PD-L1 interactions⁷ . By studying mouse models, we can gain insights into treatments for cancer and autoimmune diseases. It's crucial to understand the species-specific differences in PD-1 biology to effectively translate findings from mouse models into human models.

Mouse

Q02242

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Lyophilized

35-45kDA

~17kDa

0.22µm filtered and Lyophilized

Reconstitute at 1mg/ml using filtered deionized water. Gently mix by vortexing and/or inversion for 5 minutes or until fully dissolved. Centrifuge if necessary.

1 month, 2 to 8 °C under sterile conditions after opening and reconstituting.
1 year from date of receipt, -20 to -80 °C as supplied. 3 months from date of receipt, -20 to -80 °C sterile conditions after opening and reconstituting.

Ambient

PD-L1

Mouse

Research Use Only

1. Bally APR, Austin JW, Boss JM. The Journal of Immunology. 2016;196(6):2431-2437.
2. Cheng X, Veverka V, Radhakrishnan A, et al. Journal of Biological Chemistry. 2013;288(17):11771-11785.
3. Salmaninejad A, Valilou SF, Shabgah AG, et al. J Cell Physiol. 2019;234(10):16824-16837.
4. Dermani FK, Samadi P, Rahmani G, Kohlan AK, Najafi R. Journal of Cellular Physiology. 2019;234(2):1313-1325.
5. McDermott DF, Atkins MB. Cancer Medicine. 2013;2(5):662-673.
6. Zitvogel L, Kroemer G. OncoImmunology. 2012;1(8):1223-1225.
7. Liu D, Wang S, Bindeman W. Journal of Hematology & Oncology. 2017;10(1):110.