Recombinant Streptavidin (From E.coli) — Purified No Carrier Protein
Recombinant Streptavidin (From E.coli) — Purified No Carrier Protein
Product No.: S204
- -
- -
BackgroundStreptavidin is a biotin binding protein present in the fermentation broth of the bacterium Streptomyces avidinii. Each molecule of streptavidin can bind four molecules of biotin with a high affinity constant (Kd~10
-15). Unlike native avidin, streptavidin is not glycosylated and has a near neutral isoelectric point (pI ~ 5-6) vs a pI of 10 for native avidin. Protein DetailsSpecies Human Format Purified Purity ≥95% by SDS Page Amino Acid Sequence DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ State of Matter Lyophilized Predicted Molecular Mass 55 kDa Formulation Lyophilized from 0.01M PBS, pH 7.2-7.4, 150mM NaCl with no carrier protein, calcium, potassium or preservatives added. Reconstitution Reconstitute in highly pure deionized water to 1 mg/ml. Gently mix by vortexing and/or inversion for 5 minutes or until fully dissolved. Centrifuge if necessary.
Storage and Stability The lyophilized streptavidin is stable for at least one year from date of receipt when stored at -20°C to -80°C. Reconstituted streptavidin is stable for 3 months from date of reconstitution when stored at -20°C to -80°C. Store in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Next Day 2-8°C Ligand/Receptor Biotin Species Human Regulatory Status Research Use Only UniProt.org Technical Protocols  IF    Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.
