RBD Enzyme Conjugate (100X)

RBD Enzyme Conjugate (100X)

Product No.: S861

- -
- -
Alternate Names
Spike Protein, SARS-CoV-2 Spike Protein, S1 Protein, S1 Subunit, S Protein, Receptor Binding Domain, RBD
Product Type
Recombinant Protein
Expression Host
HEK-293 Cells
Species
SARS-CoV-2
Virus
Applications
ELISA

- -
- -
Select Product Size
- -
- -

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of coronavirus disease 2019 (COVID-19), is an enveloped, single-stranded, positive-sense RNA virus that belongs to the Coronaviridae family 1. The SARS-CoV-2 genome, which shares 79.6% identity with SARS-CoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) 2. The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells 3. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. S1 contains two major domains, the N-terminal (NTD) and C-terminal domains (CTD). The CTD contains the receptor-binding domain (RBD), which binds to the angiotensin-converting enzyme 2 (ACE2) receptor on host cells 3-5. Although both SARS-CoV and SARS-CoV-2 bind the ACE2 receptor, the RBDs only share ~73% amino acid identity, and the SARS-CoV-2 RBD binds with a higher affinity compared to SARS-CoV 3, 6. The RBD is dynamic and undergoes hinge-like conformational changes, referred to as the “down” or “up” conformations, which hide or expose the receptor-binding motifs, respectively 7. Following receptor binding, S1 destabilizes, and TMPRSS2 cleaves S2, which undergoes a pre- to post-fusion conformation transition, allowing for membrane fusion 8, 9.

Polyclonal RBD-specific antibodies can block ACE2 binding 10, 11, and anti-RBD neutralizing antibodies are present in the sera of convalescent COVID19 patients 12, identifying the RBD as an attractive candidate for vaccines and therapeutics. In addition, the RBD is poorly conserved, making it a promising antigen for diagnostic tests 13 14. Serologic tests for the RBD are highly sensitive and specific for detecting SARS-CoV-2 antibodies in COVID19 patients 13 15. Furthermore, the levels of anti-RBD antibodies correlated with SARS-CoV-2 neutralizing antibodies, suggesting the RBD could be used to predict an individual's risk of disease 13.

Protein Details

Format
Purified No Carrier Protein
Purity
>95% by SDS Page
Product Concentration
0.5 mg/ml
Endotoxin Level
<0.10 EU per 1 μg of the protein by the LAL method
Protein Accession No.
Amino Acid Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESN KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS
State of Matter
Sterile Liquid
Predicted Molecular Mass
The predicted molecular mass is ~33 kDa.
Predicted Molecular Mass
~33 kDa
Formulation
This RBD Enzyme Conjugate or HRP-conjugated recombinant protein is formulated in 0.01 M phosphate buffered saline (150 mM NaCl) PBS pH 7.2 - 7.4, 1% BSA with ProClin-300 as a preservative. (Warning: Use of sodium azide as a preservative will inhibit the enzyme activity of horseradish peroxidase)
Storage and Stability
This horseradish peroxidase conjugated recombinant protein is stable when stored at 2-8°C for up to 6 month.
Country of Origin
USA
Shipping
Next Day Ice Pack
NCBI Gene Bank
Applications and Recommended Usage ?
(Quality Tested by Leinco)
ELISA

References & Citations

1. Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.
2. Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020.
3. Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.02.11.944462. 2020.
4. Walls AC, Park YJ, Tortorici MA, Wall A, McGuire AT, Veesler D. Cell. 181(2):281-292.e6. 2020.
5. Li W, Zhang C, Sui J, et al. EMBO J. 24(8):1634-1643. 2005.
6. Shang, J., Ye, G., Shi, K. et al. Nature 581, 221–224. 2020.
7. Gui M, Song W, Zhou H, et al. Cell Res. 27(1):119-129. 2017.
8. Walls AC, Tortorici MA, Snijder J, et al. Proc Natl Acad Sci U S A. 114(42):11157-11162. 2017.
9. Hoffmann M, Kleine-Weber H, Schroeder S, et al. Cell. 181(2):271-280.e8. 2020.
10. Huo J, Zhao Y, Ren J, et al. Cell Host Microbe. S1931-3128(20)30351-6. 2020.
11. Tai, W., He, L., Zhang, X. et al. Cell Mol Immunol 17, 613–620. 2020.
12. Cao Y, Su B, Guo X, et al. Cell. 182(1):73-84.e16. 2020.
13. Premkumar L, Segovia-Chumbez B, Jadi R, et al. medRxiv; 2020.
14. Quinlan BD, Mou H, Zhang L, et al. bioRxiv; 2020.
15. Olba NM, Muller MA, Li W, et al. medRxiv; 2020.
Indirect ELISA Protocol

Certificate of Analysis

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Disclaimer AlertProducts are for research use only. Not for use in diagnostic or therapeutic procedures.